PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01265.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family MYB_related
Protein Properties Length: 60aa    MW: 6795.81 Da    PI: 8.8835
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01265.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.75.5e-081445132
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                      +g WT+eEd +l  + +q+  g+W+  + + g
  Migut.L01265.1.p 14 KGVWTPEEDNKLFTYMQQHAHGNWRDLPLKAG 45
                      799*********************99887777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-11543IPR009057Homeodomain-like
SuperFamilySSF466891.79E-8854IPR009057Homeodomain-like
PROSITE profilePS500906.435950IPR017877Myb-like domain
PfamPF002495.3E-61445IPR001005SANT/Myb domain
CDDcd001671.52E-41755No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRSPCCDKV GTKKGVWTPE EDNKLFTYMQ QHAHGNWRDL PLKAGTYVRT YVSIICIHN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ1973663e-33HQ197366.1 Mimulus guttatus isolate B MYB transcription factor MIXTA-like 1 (MYBML1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664663.12e-19PREDICTED: myb-related protein 306-like isoform X1
RefseqXP_012841338.12e-19PREDICTED: snRNA-activating protein complex subunit 4
SwissprotQ7XBH43e-18MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A022QME85e-31A0A022QME8_ERYGU; Uncharacterized protein
STRINGGRMZM2G079123_P016e-19(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1548477
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.22e-21myb domain protein 16